Recombinant Malus domestica Major allergen Mal d 1 (MALD1), Unconjugated, E. coli

Artikelnummer: BIM-RPC20332
Artikelname: Recombinant Malus domestica Major allergen Mal d 1 (MALD1), Unconjugated, E. coli
Artikelnummer: BIM-RPC20332
Hersteller Artikelnummer: RPC20332
Alternativnummer: BIM-RPC20332-20UG,BIM-RPC20332-100UG,BIM-RPC20332-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Plant
Konjugation: Unconjugated
Alternative Synonym: Allergen Mal d IAllergen: Mal d 1
Recombinant Malus domestica Major allergen Mal d 1 (MALD1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Malus domestica (Apple) (Pyrus malus). Target Name: MALD1. Target Synonyms: Allergen Mal d IAllergen: Mal d 1. Accession Number: P43211. Expression Region: 2~159aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 33.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 33.5kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHYHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN
Target-Kategorie: MALD1