Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit alpha, Unconjugated, E. coli

Artikelnummer: BIM-RPC20337
Artikelname: Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit alpha, Unconjugated, E. coli
Artikelnummer: BIM-RPC20337
Hersteller Artikelnummer: RPC20337
Alternativnummer: BIM-RPC20337-20UG,BIM-RPC20337-100UG,BIM-RPC20337-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Reptile
Konjugation: Unconjugated
Alternative Synonym: Aggretin alpha chainRhodoaggretin subunit alpha
Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit alpha is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Calloselasma rhodostoma (Malayan pit viper) (Agkistrodon rhodostoma). Target Name: Calloselasma rhodostoma Snaclec rhodocytin subunit alpha. Target Synonyms: Aggretin alpha chainRhodoaggretin subunit alpha. Accession Number: Q9I841. Expression Region: 1~136aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 31.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 31.8kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: GLEDCDFGWSPYDQHCYQAFNEQKTWDEAEKFCRAQENGAHLASIESNGEADFVSWLISQKDELADEDYVWIGLRAQNKEQQCSSEWSDGSSVSYENLIDLHTKKCGALEKLTGFRKWVNYYCEQMHAFVCKLLPY
Target-Kategorie: Calloselasma rhodostoma Snaclec rhodocytin subunit alpha