Recombinant Human Semenogelin-1 (SEMG1), Unconjugated, E. coli

Artikelnummer: BIM-RPC20353
Artikelname: Recombinant Human Semenogelin-1 (SEMG1), Unconjugated, E. coli
Artikelnummer: BIM-RPC20353
Hersteller Artikelnummer: RPC20353
Alternativnummer: BIM-RPC20353-20UG,BIM-RPC20353-100UG,BIM-RPC20353-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Cancer/testis antigen 103Semenogelin ISGICleaved into the following 3 chains:Alpha-inhibin-92Alpha-inhibin-31Seminal basic protein
Recombinant Human Semenogelin-1 (SEMG1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: SEMG1. Target Synonyms: Cancer/testis antigen 103Semenogelin ISGICleaved into the following 3 chains:Alpha-inhibin-92Alpha-inhibin-31Seminal basic protein. Accession Number: P04279. Expression Region: 24~402aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 58.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 58.8kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: QKGGSKGRLPSEFSQFPHGQKGQHYSGQKGKQQTESKGSFSIQYTYHVDANDHDQSRKSQQYDLNALHKTTKSQRHLGGSQQLLHNKQEGRDHDKSKGHFHRVVIHHKGGKAHRGTQNPSQDQGNSPSGKGISSQYSNTEERLWVHGLSKEQTSVSGAQKGRKQGGSQSSYVLQTEELVANKQQRETKNSHQNKGHYQNVVEVREEHSSKVQTSLCPAHQDKLQHGSKDIFSTQDELLVYNKNQHQTKNLNQDQQ
Target-Kategorie: SEMG1