Recombinant Carica papaya Papain, Unconjugated, E. coli

Artikelnummer: BIM-RPC20385
Artikelname: Recombinant Carica papaya Papain, Unconjugated, E. coli
Artikelnummer: BIM-RPC20385
Hersteller Artikelnummer: RPC20385
Alternativnummer: BIM-RPC20385-20UG,BIM-RPC20385-100UG,BIM-RPC20385-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Plant
Konjugation: Unconjugated
Alternative Synonym: Papaya proteinase IPPI
Recombinant Carica papaya Papain is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Carica papaya (Papaya). Target Name: Carica papaya Papain. Target Synonyms: Papaya proteinase IPPI. Accession Number: P00784. Expression Region: 134~345aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 27.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 27.4kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Target-Kategorie: Carica papaya Papain