Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 7 (CEACAM7), Unconjugated, E. coli

Artikelnummer: BIM-RPC20387
Artikelname: Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 7 (CEACAM7), Unconjugated, E. coli
Artikelnummer: BIM-RPC20387
Hersteller Artikelnummer: RPC20387
Alternativnummer: BIM-RPC20387-20UG,BIM-RPC20387-100UG,BIM-RPC20387-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Carcinoembryonic antigen CGM2
Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 7 (CEACAM7) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CEACAM7. Target Synonyms: Carcinoembryonic antigen CGM2. Accession Number: Q14002. Expression Region: 36~242aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 39.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 39.4kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGIYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGPYECEIQNPVGASRSDPVTLNVRYESVQAS
Target-Kategorie: CEACAM7