Recombinant Chlamydia trachomatis Small cysteine-rich outer membrane protein OmcA (OmcA), Unconjugated, E. coli

Artikelnummer: BIM-RPC20395
Artikelname: Recombinant Chlamydia trachomatis Small cysteine-rich outer membrane protein OmcA (OmcA), Unconjugated, E. coli
Artikelnummer: BIM-RPC20395
Hersteller Artikelnummer: RPC20395
Alternativnummer: BIM-RPC20395-20UG,BIM-RPC20395-100UG,BIM-RPC20395-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: 9 kDa cysteine-rich lipoprotein9 kDa-CRP
Recombinant Chlamydia trachomatis Small cysteine-rich outer membrane protein OmcA (OmcA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Chlamydia trachomatis (strain D/UW-3/Cx). Target Name: omcA. Target Synonyms: 9 kDa cysteine-rich lipoprotein9 kDa-CRP. Accession Number: P0CC05. Expression Region: 19~88aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 23.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 23.4kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: CCRIVDCCFEDPCAPIQCSPCESKKKDVDGGCNSCNGYVPACKPCGGDTHQDAKHGPQARGIPVDGKCRQ
Target-Kategorie: omcA