Recombinant Staphylococcus aureus 30 kDa neutral phosphatase is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Staphylococcus aureus. Target Name: Staphylococcus aureus 30 kDa neutral phosphatase. Target Synonyms: NPTase. Accession Number: P21222. Expression Region: 1~35aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 19.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht:
19.7kDa
Tag:
N-Terminal 6Xhis-Sumo-Tagged
Puffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit:
>90% by SDS-PAGE
Sequenz:
KSSAEVQQTQQASIPASQKANLGNQNNIMSVASYQ
Target-Kategorie:
Staphylococcus aureus 30 kDa neutral phosphatase
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten
