Recombinant Mouse Nucleophosmin (Npm1), Unconjugated, E. coli

Artikelnummer: BIM-RPC20406
Artikelname: Recombinant Mouse Nucleophosmin (Npm1), Unconjugated, E. coli
Artikelnummer: BIM-RPC20406
Hersteller Artikelnummer: RPC20406
Alternativnummer: BIM-RPC20406-20UG,BIM-RPC20406-100UG,BIM-RPC20406-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: Nucleolar phosphoprotein B23Nucleolar protein NO38Numatrin
Recombinant Mouse Nucleophosmin (Npm1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Npm1. Target Synonyms: Nucleolar phosphoprotein B23Nucleolar protein NO38Numatrin. Accession Number: Q61937. Expression Region: 1~292aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 48.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 48.6kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDEDDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEK
Target-Kategorie: Npm1