Recombinant Mouse Lithostathine-1 (Reg1), Unconjugated, E. coli

Artikelnummer: BIM-RPC20409
Artikelname: Recombinant Mouse Lithostathine-1 (Reg1), Unconjugated, E. coli
Artikelnummer: BIM-RPC20409
Hersteller Artikelnummer: RPC20409
Alternativnummer: BIM-RPC20409-20UG,BIM-RPC20409-100UG,BIM-RPC20409-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: Islet of Langerhans regenerating protein 1REG 1Pancreatic stone protein 1PSPPancreatic thread protein 1PTPRegenerating protein 1
Recombinant Mouse Lithostathine-1 (Reg1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Reg1. Target Synonyms: Islet of Langerhans regenerating protein 1REG 1Pancreatic stone protein 1PSPPancreatic thread protein 1PTPRegenerating protein 1. Accession Number: P43137. Expression Region: 22~165aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 32.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 32.2kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: QEAEEDLPSARISCPEGSNAYSSYCYYFTEDRLTWADADLFCQNMNSGYLVSVLSQAEGNFVASLIKESGTTDANVWTGLHDPKRNRRWHWSSGSLFLYKSWATGSPNSSNRGYCVSLTSNTGYKKWKDDNCDAQYSFVCKFKG
Target-Kategorie: Reg1