Recombinant Arabidopsis thaliana Osmotin-like protein OSM34 (OSM34), Unconjugated, E. coli

Artikelnummer: BIM-RPC20422
Artikelname: Recombinant Arabidopsis thaliana Osmotin-like protein OSM34 (OSM34), Unconjugated, E. coli
Artikelnummer: BIM-RPC20422
Hersteller Artikelnummer: RPC20422
Alternativnummer: BIM-RPC20422-20UG,BIM-RPC20422-100UG,BIM-RPC20422-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: A. thaliana
Konjugation: Unconjugated
Alternative Synonym: OSL3_ARATH, OSM34, Osmotin-like protein OSM34
Recombinant Arabidopsis thaliana Osmotin-like protein OSM34 (OSM34) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Arabidopsis thaliana (Mouse-ear cress). Target Name: OSM34. Target Synonyms: OSL3_ARATH, OSM34, Osmotin-like protein OSM34. Accession Number: P50700. Expression Region: 23~244aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 44.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 44.4kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: ATFEILNQCSYTVWAAASPGGGRRLDAGQSWRLDVAAGTKMARIWGRTNCNFDSSGRGRCQTGDCSGGLQCTGWGQPPNTLAEYALNQFNNLDFYDISLVDGFNIPMEFSPTSSNCHRILCTADINGQCPNVLRAPGGCNNPCTVFQTNQYCCTNGQGSCSDTEYSRFFKQRCPDAYSYPQDDPTSTFTCTNTNYRVVFCPRSRLGATGSHQLPIKMVTEEN
Target-Kategorie: OSM34