Recombinant Ceratopteris richardii Cyanovirin-N homolog, Unconjugated, Yeast

Artikelnummer: BIM-RPC20424
Artikelname: Recombinant Ceratopteris richardii Cyanovirin-N homolog, Unconjugated, Yeast
Artikelnummer: BIM-RPC20424
Hersteller Artikelnummer: RPC20424
Alternativnummer: BIM-RPC20424-20UG,BIM-RPC20424-100UG,BIM-RPC20424-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Konjugation: Unconjugated
Alternative Synonym: Cyanovirin-N homolog, CV-N homolog
Recombinant Ceratopteris richardii Cyanovirin-N homolog is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Ceratopteris richardii (Triangle waterfern). Target Name: Ceratopteris richardii Cyanovirin-N homolog. Target Synonyms: Cyanovirin-N homolog, CV-N homolog. Accession Number: P86326. Expression Region: 28~142aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 14.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 14.4kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: QCNFANSCTGVELYGYILRGDCINEDGHPHATSINLNYYIGNDNGRLEYPGESFGSSCVKTALNDGHTLTASCKGADGQYHDSSMDLNYVVGNSYGYMEPCRASNADHVLKSSSE
Target-Kategorie: Ceratopteris richardii Cyanovirin-N homolog