Recombinant Shigella dysenteriae serotype 1 60KDA chaperonin (groL), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC20427
Artikelname: Recombinant Shigella dysenteriae serotype 1 60KDA chaperonin (groL), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC20427
Hersteller Artikelnummer: RPC20427
Alternativnummer: BIM-RPC20427-20UG,BIM-RPC20427-100UG,BIM-RPC20427-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Konjugation: Unconjugated
Alternative Synonym: GroEL protein, Protein Cpn60
Recombinant Shigella dysenteriae serotype 1 60KDA chaperonin (groL), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Shigella dysenteriae serotype 1 (strain Sd197). Target Name: groL. Target Synonyms: GroEL protein, Protein Cpn60. Accession Number: Q328C4. Expression Region: 101~548aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 66.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 66.9kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: TEGLKAVAAGMNPMDLKRGIDKAVTAAVEELKALSVPCSDSKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIATLTGGTVISEEIGMELEKATLEDLGQAKRVVINKDTTTIIDGVGEEAAIQGRVAQIRQQIEE
Target-Kategorie: groL