Recombinant Mesomycoplasma hyopneumoniae 46 kDa surface antigen (p46), Unconjugated, E. coli

Artikelnummer: BIM-RPC20439
Artikelname: Recombinant Mesomycoplasma hyopneumoniae 46 kDa surface antigen (p46), Unconjugated, E. coli
Artikelnummer: BIM-RPC20439
Hersteller Artikelnummer: RPC20439
Alternativnummer: BIM-RPC20439-20UG,BIM-RPC20439-100UG,BIM-RPC20439-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Konjugation: Unconjugated
Alternative Synonym: p46
Recombinant Mesomycoplasma hyopneumoniae 46 kDa surface antigen (p46) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mesomycoplasma hyopneumoniae (strain 232). Target Name: p46. Target Synonyms: p46. Accession Number: P0C0J7. Expression Region: 28~416aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 58.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 58.5kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: CGQTESGSTSDSKPQAETLKHKVSNDSIRIALTDPDNPRWISAQKDIISYVDETEAATSTITKNQDAQNNWLTQQANLSPAPKGFIIAPENGSGVGTAVNTIADKGIPIVAYDRLITGSDKYDWYVSFDNEKVGELQGLSLAAGLLGKEDGAFDSIDQMNEYLKSHMPQETISFYTIAGSQDDNNSQYFYNGAMKVLKELMKNSQNKIIDLSPEGENAVYVPGWNYGTAGQRIQSFLTINKDPAGGNKIKAVGSK
Target-Kategorie: p46