Recombinant Neisseria meningitidis serogroup B / serotype 15 Major outer membrane protein P.IB (porB), Unconjugated, E. coli

Artikelnummer: BIM-RPC20457
Artikelname: Recombinant Neisseria meningitidis serogroup B / serotype 15 Major outer membrane protein P.IB (porB), Unconjugated, E. coli
Artikelnummer: BIM-RPC20457
Hersteller Artikelnummer: RPC20457
Alternativnummer: BIM-RPC20457-20UG,BIM-RPC20457-100UG,BIM-RPC20457-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: Class 3 proteinPorin
Recombinant Neisseria meningitidis serogroup B / serotype 15 Major outer membrane protein P.IB (porB) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Neisseria meningitidis serogroup B / serotype 15 (strain H44/76). Target Name: porB. Target Synonyms: Class 3 proteinPorin. Accession Number: E6MZM0. Expression Region: 20~331aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 49.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 49.8kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: DVTLYGTIKAGVETSRSVFHQNGQVTEVTTATGIVDLGSKIGFKGQEDLGNGLKAIWQVEQKASIAGTDSGWGNRQSFIGLKGGFGKLRVGRLNSVLKDTGDINPWDSKSDYLGVNKIAEPEARLISVRYDSPEFAGLSGSVQYALNDNAGRHNSESYHAGFNYKNGGFFVQYGGAYKRHHQVQEGLNIEKYQIHRLVSGYDNDALYASVAVQQQDAKLTDASNSHNSQTEVAATLAYRFGNVTPRVSYAHGFKG
Target-Kategorie: porB