Recombinant Staphylococcus aureus Enterotoxin type H (entH), Unconjugated, Yeast

Artikelnummer: BIM-RPC20463
Artikelname: Recombinant Staphylococcus aureus Enterotoxin type H (entH), Unconjugated, Yeast
Artikelnummer: BIM-RPC20463
Hersteller Artikelnummer: RPC20463
Alternativnummer: BIM-RPC20463-20UG,BIM-RPC20463-100UG,BIM-RPC20463-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: SEH
Recombinant Staphylococcus aureus Enterotoxin type H (entH) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Staphylococcus aureus. Target Name: entH. Target Synonyms: SEH. Accession Number: P0A0M0. Expression Region: 25~241aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 27.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 27.1kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: EDLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYTKKKV
Target-Kategorie: entH