Recombinant Human HLA class II histocompatibility antigen, DRB1 beta chain (HLA-DRB1), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC20468
Artikelname: Recombinant Human HLA class II histocompatibility antigen, DRB1 beta chain (HLA-DRB1), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC20468
Hersteller Artikelnummer: RPC20468
Alternativnummer: BIM-RPC20468-20UG,BIM-RPC20468-100UG,BIM-RPC20468-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: MHC class II antigen DRB1*1
Recombinant Human HLA class II histocompatibility antigen, DRB1 beta chain (HLA-DRB1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: HLA-DRB1. Target Synonyms: MHC class II antigen DRB1*1. Accession Number: P04229. Expression Region: 30~227aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 42.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 42.9kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: GDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSK
Target-Kategorie: HLA-DRB1