Recombinant Mouse Granzyme A (Gzma), Unconjugated, E. coli

Artikelnummer: BIM-RPC20502
Artikelname: Recombinant Mouse Granzyme A (Gzma), Unconjugated, E. coli
Artikelnummer: BIM-RPC20502
Hersteller Artikelnummer: RPC20502
Alternativnummer: BIM-RPC20502-20UG,BIM-RPC20502-100UG,BIM-RPC20502-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: Autocrine thymic lymphoma granzyme-like serine proteaseCTLA-3Fragmentin-1T cell-specific serine protease 1
Recombinant Mouse Granzyme A (Gzma) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Gzma. Target Synonyms: Autocrine thymic lymphoma granzyme-like serine proteaseCTLA-3Fragmentin-1T cell-specific serine protease 1. Accession Number: P11032. Expression Region: 29~260aa. Tag Info: N-Terminal 6Xhis-B2M-Tagged. Theoretical MW: 39.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 39.6kDa
Tag: N-Terminal 6Xhis-B2M-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: IIGGDTVVPHSRPYMALLKLSSNTICAGALIEKNWVLTAAHCNVGKRSKFILGAHSINKEPEQQILTVKKAFPYPCYDEYTREGDLQLVRLKKKATVNRNVAILHLPKKGDDVKPGTRCRVAGWGRFGNKSAPSETLREVNITVIDRKICNDEKHYNFHPVIGLNMICAGDLRGGKDSCNGDSGSPLLCDGILRGITSFGGEKCGDRRWPGVYTFLSDKHLNWIKKIMKGSV
Target-Kategorie: Gzma