Recombinant E. coli Putative binding protein ygiS (ygiS), Unconjugated

Artikelnummer: BIM-RPC20515
Artikelname: Recombinant E. coli Putative binding protein ygiS (ygiS), Unconjugated
Artikelnummer: BIM-RPC20515
Hersteller Artikelnummer: RPC20515
Alternativnummer: BIM-RPC20515-20UG,BIM-RPC20515-100UG,BIM-RPC20515-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: E. coli
Konjugation: Unconjugated
Alternative Synonym: ygiS, b3020, JW2988, Probable deoxycholate-binding periplasmic protein YgiS
Recombinant E. coli Putative binding protein ygiS (ygiS) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli (strain K12). Target Name: ygiS. Target Synonyms: ygiS, b3020, JW2988, Probable deoxycholate-binding periplasmic protein YgiS. Accession Number: Q46863. Expression Region: 21~535aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 74.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 74.4kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: ADVPANTPLAPQQVFRYNNHSDPGTLDPQKVEENTAAQIVLDLFEGLVWMDGEGQVQPAQAERWEILDGGKRYIFHLRSGLQWSDGQPLTAEDFVLGWQRAVDPKTASPFAGYLAQAHINNAAAIVAGKADVTSLGVKATDDRTLEVTLEQPVPWFTTMLAWPTLFPVPHHVIAKHGDSWSKPENMVYNGAFVLDQWVVNEKITARKNPKYRDAQHTVLQQVEYLALDNSVTGYNRYRAGEVDLTWVPAQQIPAI
Target-Kategorie: ygiS