Recombinant E. coli Periplasmic murein peptide-binding protein (mppA), Unconjugated

Artikelnummer: BIM-RPC20517
Artikelname: Recombinant E. coli Periplasmic murein peptide-binding protein (mppA), Unconjugated
Artikelnummer: BIM-RPC20517
Hersteller Artikelnummer: RPC20517
Alternativnummer: BIM-RPC20517-20UG,BIM-RPC20517-100UG,BIM-RPC20517-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: E. coli
Konjugation: Unconjugated
Alternative Synonym: mppA, ynaH, b1329, JW1322, Periplasmic murein peptide-binding protein
Recombinant E. coli Periplasmic murein peptide-binding protein (mppA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli (strain K12). Target Name: mppA. Target Synonyms: mppA, ynaH, b1329, JW1322, Periplasmic murein peptide-binding protein. Accession Number: P77348. Expression Region: 23~537aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 73.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 73.6kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: AEVPSGTVLAEKQELVRHIKDEPASLDPAKAVGLPEIQVIRDLFEGLVNQNEKGEIVPGVATQWKSNDNRIWTFTLRDNAKWADGTPVTAQDFVYSWQRLVDPKTLSPFAWFAALAGINNAQAIIDGKATPDQLGVTAVDAHTLKIQLDKPLPWFVNLTANFAFFPVQKANVESGKEWTKPGNLIGNGAYVLKERVVNEKLVVVPNTHYWDNAKTVLQKVTFLPINQESAATKRYLAGDIDITESFPKNMYQKLL
Target-Kategorie: mppA