Recombinant Neisseria meningitidis serogroup B Penicillin-binding protein 1A (mrcA), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC20531
Artikelname: Recombinant Neisseria meningitidis serogroup B Penicillin-binding protein 1A (mrcA), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC20531
Hersteller Artikelnummer: RPC20531
Alternativnummer: BIM-RPC20531-20UG,BIM-RPC20531-100UG,BIM-RPC20531-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: Peptidoglycan TGaseDD-transpeptidase
Recombinant Neisseria meningitidis serogroup B Penicillin-binding protein 1A (mrcA), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Neisseria meningitidis serogroup B (strain MC58). Target Name: mrcA. Target Synonyms: Peptidoglycan TGaseDD-transpeptidase. Accession Number: P0A0Z6. Expression Region: 206~413aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 40kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 40kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: KAPSAYNPIVNPERAKLRQKYILNNMLEEKMITVQQRDQALNEELHYERFVRKIDQSALYVAEMVRQELYEKYGEDAYTQGFKVYTTVRADHQKVATEALRKALRNFDRGSSYRGAENYIDLSKSEDVEETVSQYLSGLYTVDKMVPAVVLDVTKKKNVVIQLPGGRRVTLDRRALGFAARAVNNEKMGEDRIRRGAVIRVKNNGGRW
Target-Kategorie: mrcA