Recombinant Bovine Interferon omega-1 (IFNW1), Unconjugated, E. coli

Artikelnummer: BIM-RPC20536
Artikelname: Recombinant Bovine Interferon omega-1 (IFNW1), Unconjugated, E. coli
Artikelnummer: BIM-RPC20536
Hersteller Artikelnummer: RPC20536
Alternativnummer: BIM-RPC20536-20UG,BIM-RPC20536-100UG,BIM-RPC20536-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bovine
Konjugation: Unconjugated
Alternative Synonym: IFN-omega-c1Interferon alpha-II-1
Recombinant Bovine Interferon omega-1 (IFNW1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bovine (Bos taurus). Target Name: IFNW1. Target Synonyms: IFN-omega-c1Interferon alpha-II-1. Accession Number: P07352. Expression Region: 24~195aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 35.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 35.7kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: CDLSPNHVLVGRQNLRLLGQMRRLSPRFCLQDRKDFAFPQEMVEVSQFQEAQAISVLHEMLQQSFNLFHKERSSAAWDTTLLEQLLTGLHQQLDDLDACLGLLTGEEDSALGRTGPTLAMKRYFQGIHVYLQEKGYSDCAWEIVRLEIMRSLSSSTSLQERLRMMDGDLKSP
Target-Kategorie: IFNW1