Recombinant Rat Frataxin, mitochondrial (Fxn), Unconjugated, E. coli

Artikelnummer: BIM-RPC20538
Artikelname: Recombinant Rat Frataxin, mitochondrial (Fxn), Unconjugated, E. coli
Artikelnummer: BIM-RPC20538
Hersteller Artikelnummer: RPC20538
Alternativnummer: BIM-RPC20538-20UG,BIM-RPC20538-100UG,BIM-RPC20538-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Rat
Konjugation: Unconjugated
Alternative Synonym: FxnFrataxin, mitochondrial, Fxn, EC 1.16.3.1, Cleaved into: Frataxin intermediate form, Frataxin mature form
Recombinant Rat Frataxin, mitochondrial (Fxn) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus). Target Name: Fxn. Target Synonyms: FxnFrataxin, mitochondrial, Fxn, EC 1.16.3.1, Cleaved into: Frataxin intermediate form, Frataxin mature form. Accession Number: D3ZYW7. Expression Region: 41~208aa. Tag Info: Tag-Free. Theoretical MW: 18.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 18.6kDa
Tag: Tag-Free
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: LHVTANADAIRHSHLNLHYLGQILNIKKQSVCVVHLRNSGTLGNPSSLDETAYERLAEETLDALAEFFEDLADKPYTLKDYDVSFGDGVLTIKLGGDLGTYVINKQTPLLYLWFSGPCSGPKRYDWTGKNWVYSHDGVSLHELLARELTEALNTKLDLSSLAYSGKGT
Target-Kategorie: Fxn