Recombinant Shigella flexneri Adenylate kinase (adk), Unconjugated, E. coli

Artikelnummer: BIM-RPC20547
Artikelname: Recombinant Shigella flexneri Adenylate kinase (adk), Unconjugated, E. coli
Artikelnummer: BIM-RPC20547
Hersteller Artikelnummer: RPC20547
Alternativnummer: BIM-RPC20547-20UG,BIM-RPC20547-100UG,BIM-RPC20547-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: ATP-AMP transphosphorylaseATP:AMP phosphotransferase Adenylate monophosphate kinase
Recombinant Shigella flexneri Adenylate kinase (adk) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Shigella flexneri. Target Name: adk. Target Synonyms: ATP-AMP transphosphorylaseATP:AMP phosphotransferase Adenylate monophosphate kinase. Accession Number: Q83M40. Expression Region: 1~214aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 43.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 43.6kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKQVAEVRADLEKILG
Target-Kategorie: adk