Recombinant Pig Coagulation factor XII (F12), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC21290
Artikelname: Recombinant Pig Coagulation factor XII (F12), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC21290
Hersteller Artikelnummer: RPC21290
Alternativnummer: BIM-RPC21290-20UG,BIM-RPC21290-100UG,BIM-RPC21290-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Porcine
Konjugation: Unconjugated
Alternative Synonym: Hageman factorHAF
Recombinant Pig Coagulation factor XII (F12), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Pig (Sus scrofa, Porcine). Target Name: F12. Target Synonyms: Hageman factorHAF. Accession Number: O97507. Expression Region: 20~371aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 43.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 43.8kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: IPPWKDPRKHKVMASEHTVVLTVTGEPCHFPFQYYRQLYYKCIQRGQRGPRPWCATTPNFEKDQRWAYCLEPMKVKDHCNKGNPCQKGGTCVNMPNGPHCICPDHFTGKHCQKEKCFEPQFLQFFQENEIWHRFEPAGVSKCQCKGPKAQCKPVASQVCSTNPCLNGGSCLQTEGHRLCRCPTGYAGRLCDVDLKERCYSDRGLSYRGMAQTTLSGAPCQPWASEATYWNMTAEQALNWGLGDHAFCRNPDNDTR
Target-Kategorie: F12