Recombinant Human PCNA-associated factor (PCLAF), Unconjugated, E. coli

Artikelnummer: BIM-RPC21560
Artikelname: Recombinant Human PCNA-associated factor (PCLAF), Unconjugated, E. coli
Artikelnummer: BIM-RPC21560
Hersteller Artikelnummer: RPC21560
Alternativnummer: BIM-RPC21560-20UG,BIM-RPC21560-100UG,BIM-RPC21560-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Hepatitis C virus NS5A-transactivated protein 9, HCV NS5A-transactivated protein 9Overexpressed in anaplastic thyroid carcinoma 1, OEATC-1, PCNA-associated factor of 15 kDa, PAF15, p15PAF
Recombinant Human PCNA-associated factor (PCLAF) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: PCLAF. Target Synonyms: Hepatitis C virus NS5A-transactivated protein 9, HCV NS5A-transactivated protein 9Overexpressed in anaplastic thyroid carcinoma 1, OEATC-1, PCNA-associated factor of 15 kDa, PAF15, p15PAF. Accession Number: Q15004. Expression Region: 1~111aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 39kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 39kDa
Tag: N-Terminal Gst-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE
Target-Kategorie: PCLAF