Recombinant Human PCNA-associated factor (PCLAF), Unconjugated, E. coli

Artikelnummer: BIM-RPC21560
Artikelname: Recombinant Human PCNA-associated factor (PCLAF), Unconjugated, E. coli
Artikelnummer: BIM-RPC21560
Hersteller Artikelnummer: RPC21560
Alternativnummer: BIM-RPC21560-20UG,BIM-RPC21560-100UG,BIM-RPC21560-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Hepatitis C virus NS5A-transactivated protein 9, HCV NS5A-transactivated protein 9Overexpressed in anaplastic thyroid carcinoma 1, OEATC-1, PCNA-associated factor of 15 kDa, PAF15, p15PAF
Accession Number: Q15004. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 1~111aa. Protein Length: Full Length. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Metabolism. Shipping Condition: Ice packs. Short Description: Recombinant Human PCNA-associated factor (PCLAF) is a purified Recombinant Protein
Molekulargewicht: 39kDa
Tag: N-Terminal Gst-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE
Target-Kategorie: PCLAF