Recombinant Autographa californica nuclear polyhedrosis virus Viral cathepsin (VCATH), Unconjugated, E. coli

Artikelnummer: BIM-RPC22599
Artikelname: Recombinant Autographa californica nuclear polyhedrosis virus Viral cathepsin (VCATH), Unconjugated, E. coli
Artikelnummer: BIM-RPC22599
Hersteller Artikelnummer: RPC22599
Alternativnummer: BIM-RPC22599-20UG,BIM-RPC22599-100UG,BIM-RPC22599-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Virus
Konjugation: Unconjugated
Alternative Synonym: Cysteine proteinaseCP
Recombinant Autographa californica nuclear polyhedrosis virus Viral cathepsin (VCATH) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Autographa californica nuclear polyhedrosis virus (AcMNPV). Target Name: VCATH. Target Synonyms: Cysteine proteinaseCP. Accession Number: P25783. Expression Region: 113~323aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 39.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 39.9kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: PLEFDWRRLNKVTSVKNQGMCGACWAFATLASLESQFAIKHNQLINLSEQQMIDCDFVDAGCNGGLLHTAFEAIIKMGGVQLESDYPYEADNNNCRMNSNKFLVQVKDCYRYITVYEEKLKDLLRLVGPIPMAIDAADIVNYKQGIIKYCFNSGLNHAVLLVGYGVENNIPYWTFKNTWGTDWGEDGFFRVQQNINACGMRNELASTAVIY
Target-Kategorie: VCATH