Recombinant Rat Thyroxine 5-deiodinase (Dio3), partial (170:Umissing), Unconjugated, E. coli

Artikelnummer: BIM-RPC22615
Artikelname: Recombinant Rat Thyroxine 5-deiodinase (Dio3), partial (170:Umissing), Unconjugated, E. coli
Artikelnummer: BIM-RPC22615
Hersteller Artikelnummer: RPC22615
Alternativnummer: BIM-RPC22615-20UG,BIM-RPC22615-100UG,BIM-RPC22615-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Rat
Konjugation: Unconjugated
Alternative Synonym: 5DIIIDIOIIIType 3 DIType-III 5-deiodinase
Recombinant Rat Thyroxine 5-deiodinase (Dio3), partial (170:Umissing) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus). Target Name: Dio3. Target Synonyms: 5DIIIDIOIIIType 3 DIType-III 5-deiodinase. Accession Number: P49897. Expression Region: 63~304aa(170:Umissing). Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 31.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 31.5kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: DFLCIRKHFLRRRHPDHPEPEVELNSEGEEMPPDDPPICVSDDNRLCTLASLKAVWHGQKLDFFKQAHEGGPAPNSEVVRPDGFQSQRILDYAQGTRPLVLNFGSCTPPFMARMSAFQRLVTKYQRDVDFLIIYIEEAHPSDGWVTTDSPYVIPQHRSLEDRVSAARVLQQGAPGCALVLDTMANSSSSAYGAYFERLYVIQSGTIMYQGGRGPDGYQVSELRTWLERYDEQLHGTRPRRL
Target-Kategorie: Dio3