Recombinant Mannheimia haemolytica Leukotoxin (lktA), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC22627
Artikelname: Recombinant Mannheimia haemolytica Leukotoxin (lktA), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC22627
Hersteller Artikelnummer: RPC22627
Alternativnummer: BIM-RPC22627-20UG,BIM-RPC22627-100UG,BIM-RPC22627-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: lktALeukotoxin, Lkt
Recombinant Mannheimia haemolytica Leukotoxin (lktA), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mannheimia haemolytica (Pasteurella haemolytica). Target Name: lktA. Target Synonyms: lktALeukotoxin, Lkt. Accession Number: P55118. Expression Region: 1~229aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 29.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 29.2kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MGNKLTNISTNLKSSWLTAKSGLNRTGQSLAKAGQSLKTGAKKIILYIPKDYQYDTEKGNGLQDLVKAAEELGIEVQKEEGNDIAKAQTSLGTIQNVLGLTERGIVLSAPQLDKLLQKTKVGQAIGSAENLTKGFSNAKTVLSGIQSILGSVLAGMDLDEALQKNSNELTLAKAGLELTNSLIENIANSVKTLDAFGDQINQLGSKLQNVKGLSSLGDKLKGLSGFDKT
Target-Kategorie: lktA