Recombinant Saccharomyces cerevisiae Nicotinamidase (PNC1), Unconjugated, E. coli

Artikelnummer: BIM-RPC22629
Artikelname: Recombinant Saccharomyces cerevisiae Nicotinamidase (PNC1), Unconjugated, E. coli
Artikelnummer: BIM-RPC22629
Hersteller Artikelnummer: RPC22629
Alternativnummer: BIM-RPC22629-20UG,BIM-RPC22629-100UG,BIM-RPC22629-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Yeast
Konjugation: Unconjugated
Alternative Synonym: Nicotinamide deamidase
Recombinant Saccharomyces cerevisiae Nicotinamidase (PNC1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast). Target Name: PNC1. Target Synonyms: Nicotinamide deamidase. Accession Number: P53184. Expression Region: 1~216aa. Tag Info: Tag-Free. Theoretical MW: 25kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 25kDa
Tag: Tag-Free
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MKTLIVVDMQNDFISPLGSLTVPKGEELINPISDLMQDADRDWHRIVVTRDWHPSRHISFAKNHKDKEPYSTYTYHSPRPGDDSTQEGILWPVHCVKNTWGSQLVDQIMDQVVTKHIKIVDKGFLTDREYYSAFHDIWNFHKTDMNKYLEKHHTDEVYIVGVALEYCVKATAISAAELGYKTTVLLDYTRPISDDPEVINKVKEELKAHNINVVDK
Target-Kategorie: PNC1