Recombinant Toxocara canis 26KDA secreted antigen (TES-26), Unconjugated, E. coli

Artikelnummer: BIM-RPC22634
Artikelname: Recombinant Toxocara canis 26KDA secreted antigen (TES-26), Unconjugated, E. coli
Artikelnummer: BIM-RPC22634
Hersteller Artikelnummer: RPC22634
Alternativnummer: BIM-RPC22634-20UG,BIM-RPC22634-100UG,BIM-RPC22634-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Parasite
Konjugation: Unconjugated
Alternative Synonym: Toxocara excretory-secretory antigen 26, TES-26
Recombinant Toxocara canis 26KDA secreted antigen (TES-26) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Toxocara canis (Canine roundworm). Target Name: TES-26. Target Synonyms: Toxocara excretory-secretory antigen 26, TES-26. Accession Number: P54190. Expression Region: 22~262aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 41.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 41.9kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: QCMDSASDCAANAGSCFTRPVSQVLQNRCQRTCNTCDCRDEANNCAASINLCQNPTFEPLVRDRCQKTCGLCAGCGFISSGIVPLVVTSAPSRRVSVTFANNVQVNCGNTLTTAQVANQPTVTWEAQPNDRYTLIMVDPDFPSAANGQQGQRLHWWVINIPGNNIAGGTTLAAFQPSTPAANTGVHRYVFLVYRQPAAINSPLLNNLVVQDSERPGFGTTAFATQFNLGSPYAGNFYRSQA
Target-Kategorie: TES-26