Recombinant E. coli O6:H1 FKBP-type peptidyl-prolyl cis-trans isomerase FkpA (fkpA), Unconjugated

Artikelnummer: BIM-RPC22655
Artikelname: Recombinant E. coli O6:H1 FKBP-type peptidyl-prolyl cis-trans isomerase FkpA (fkpA), Unconjugated
Artikelnummer: BIM-RPC22655
Hersteller Artikelnummer: RPC22655
Alternativnummer: BIM-RPC22655-20UG,BIM-RPC22655-100UG,BIM-RPC22655-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: E. coli
Konjugation: Unconjugated
Alternative Synonym: Rotamase
Recombinant E. coli O6:H1 FKBP-type peptidyl-prolyl cis-trans isomerase FkpA (fkpA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC). Target Name: fkpA. Target Synonyms: Rotamase. Accession Number: P65764. Expression Region: 26~270aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 42.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 42.3kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: AEAAKPATTADSKAAFKNDDQKSAYALGASLGRYMENSLKEQEKLGIKLDKDQLIAGVQDAFADKSKLSDQEIEQTLQAFEARVKSSAQAKMEKDAADNEAKGKEYREKFAKEKGVKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRLDGVIPGWTEGLKNIKKGGKIKLVIPPELAYGKAGVPGIPPNSTLVFDVELLDVKPAPKADAKPEADAKAADSAKK
Target-Kategorie: fkpA