Recombinant Human respiratory syncytial virus A Fusion glycoprotein F0 (F), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC22677
Artikelname: Recombinant Human respiratory syncytial virus A Fusion glycoprotein F0 (F), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC22677
Hersteller Artikelnummer: RPC22677
Alternativnummer: BIM-RPC22677-20UG,BIM-RPC22677-100UG,BIM-RPC22677-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Virus
Konjugation: Unconjugated
Alternative Synonym: F, Fusion glycoprotein F0, Protein F, Cleaved into: Fusion glycoprotein F2, Interchain peptide, Fusion glycoprotein F2, Fusion glycoprotein F1
Recombinant Human respiratory syncytial virus A Fusion glycoprotein F0 (F), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human respiratory syncytial virus A (strain A2). Target Name: F. Target Synonyms: F, Fusion glycoprotein F0, Protein F, Cleaved into: Fusion glycoprotein F2, Interchain peptide, Fusion glycoprotein F2, Fusion glycoprotein F1. Accession Number: P03420. Expression Region: 27~529aa. Tag Info: N-Terminal 6Xhis-B2M-Tagged. Theoretical MW: 69.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 69.9kDa
Tag: N-Terminal 6Xhis-B2M-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: NITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIV
Target-Kategorie: F