Recombinant E. coli O6:H1 Exopolyphosphatase (ppx), Unconjugated

Artikelnummer: BIM-RPC22737
Artikelname: Recombinant E. coli O6:H1 Exopolyphosphatase (ppx), Unconjugated
Artikelnummer: BIM-RPC22737
Hersteller Artikelnummer: RPC22737
Alternativnummer: BIM-RPC22737-20UG,BIM-RPC22737-100UG,BIM-RPC22737-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: E. coli
Konjugation: Unconjugated
Alternative Synonym: Metaphosphatase
Recombinant E. coli O6:H1 Exopolyphosphatase (ppx) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC). Target Name: ppx. Target Synonyms: Metaphosphatase. Accession Number: P0AFL7. Expression Region: 2~513aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 62kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 62kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: PIHDKSPRPQEFAAVDLGSNSFHMVIARVVDGAMQIIGRLKQRVHLADGLGPDNMLSEEAMTRGLNCLSLFAERLQGFSPASVCIVGTHTLRQALNATDFLKRAEKVIPYPIEIISGNEEARLIFMGVEHTQPEKGRKLVIDIGGGSTELVIGENFEPILVESRRMGCVSFAQLYFPGGVINKENFQRARMAAAQKLETLTWQFRIQGWNVAMGASGTIKAAHEVLMEMGEKDGIITPERLEKLVKEVLRHRNFA
Target-Kategorie: ppx