Recombinant Staphylococcus aureus Toxic shock syndrome toxin-1 (tst), Unconjugated, E. coli

Artikelnummer: BIM-RPC22777
Artikelname: Recombinant Staphylococcus aureus Toxic shock syndrome toxin-1 (tst), Unconjugated, E. coli
Artikelnummer: BIM-RPC22777
Hersteller Artikelnummer: RPC22777
Alternativnummer: BIM-RPC22777-20UG,BIM-RPC22777-100UG,BIM-RPC22777-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: TSST-1
Recombinant Staphylococcus aureus Toxic shock syndrome toxin-1 (tst) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Staphylococcus aureus. Target Name: tst. Target Synonyms: TSST-1. Accession Number: P06886. Expression Region: 41~234aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 37.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 37.9kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYGPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Target-Kategorie: tst