Recombinant Bacillus thuringiensis subsp. kurstaki Pesticidal crystal protein cry1Ab (cry1Ab), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC22788
Artikelname: Recombinant Bacillus thuringiensis subsp. kurstaki Pesticidal crystal protein cry1Ab (cry1Ab), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC22788
Hersteller Artikelnummer: RPC22788
Alternativnummer: BIM-RPC22788-20UG,BIM-RPC22788-100UG,BIM-RPC22788-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: 130 kDa crystal protein, Crystaline entomocidal protoxinInsecticidal delta-endotoxin CryIA(b)
Recombinant Bacillus thuringiensis subsp. kurstaki Pesticidal crystal protein cry1Ab (cry1Ab), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bacillus thuringiensis subsp. kurstaki. Target Name: cry1Ab. Target Synonyms: 130 kDa crystal protein, Crystaline entomocidal protoxinInsecticidal delta-endotoxin CryIA(b). Accession Number: P0A370. Expression Region: 1022~1155aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 31.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 31.3kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: HEIENNTDELKFSNCVEEEVYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
Target-Kategorie: cry1Ab