Recombinant Bacillus licheniformis Subtilisin Carlsberg (apr), Unconjugated, E. coli

Artikelnummer: BIM-RPC22807
Artikelname: Recombinant Bacillus licheniformis Subtilisin Carlsberg (apr), Unconjugated, E. coli
Artikelnummer: BIM-RPC22807
Hersteller Artikelnummer: RPC22807
Alternativnummer: BIM-RPC22807-20UG,BIM-RPC22807-100UG,BIM-RPC22807-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: subC, apr, Subtilisin Carlsberg, EC 3.4.21.62
Recombinant Bacillus licheniformis Subtilisin Carlsberg (apr) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bacillus licheniformis. Target Name: apr. Target Synonyms: subC, apr, Subtilisin Carlsberg, EC 3.4.21.62. Accession Number: P00780. Expression Region: 106~379aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged. Theoretical MW: 42.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 42.0kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: AQTVPYGIPLIKADKVQAQGFKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEAYNTDGNGHGTHVAGTVAALDNTTGVLGVAPSVSLYAVKVLNSSGSGTYSGIVSGIEWATTNGMDVINMSLGGPSGSTAMKQAVDNAYARGVVVVAAAGNSGSSGNTNTIGYPAKYDSVIAVGAVDSNSNRASFSSVGAELEVMAPGAGVYSTYPTSTYATLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATY
Target-Kategorie: apr