Recombinant Gadus morhua subsp. callarias Parvalbumin beta, Unconjugated, E. coli

Artikelnummer: BIM-RPC22814
Artikelname: Recombinant Gadus morhua subsp. callarias Parvalbumin beta, Unconjugated, E. coli
Artikelnummer: BIM-RPC22814
Hersteller Artikelnummer: RPC22814
Alternativnummer: BIM-RPC22814-20UG,BIM-RPC22814-100UG,BIM-RPC22814-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Konjugation: Unconjugated
Alternative Synonym: Parvalbumin beta, Allergen Gad c I, Allergen M, allergen Gad c 1
Recombinant Gadus morhua subsp. callarias Parvalbumin beta is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Gadus morhua subsp. callarias (Baltic cod) (Gadus callarias). Target Name: Gadus morhua subsp. callarias Parvalbumin beta. Target Synonyms: Parvalbumin beta, Allergen Gad c I, Allergen M, allergen Gad c 1. Accession Number: P02622. Expression Region: 1~113aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 16.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 16.1kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: AFKGILSNADIKAAEAACFKEGSFDEDGFYAKVGLDAFSADELKKLFKIADEDKEGFIEEDELKLFLIAFAADLRALTDAETKAFLKAGDSDGDGKIGVDEFGALVDKWGAKG
Target-Kategorie: Gadus morhua subsp. callarias Parvalbumin beta