Recombinant Yellow fever virus Genome polyprotein, Unconjugated, E. coli

Artikelnummer: BIM-RPC22821
Artikelname: Recombinant Yellow fever virus Genome polyprotein, Unconjugated, E. coli
Artikelnummer: BIM-RPC22821
Hersteller Artikelnummer: RPC22821
Alternativnummer: BIM-RPC22821-20UG,BIM-RPC22821-100UG,BIM-RPC22821-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Virus
Konjugation: Unconjugated
Alternative Synonym: Core proteinMatrix proteinNS2ANS1NS2A-alphaFlavivirin protease NS2B regulatory subunitNon-structural protein 2BFlavivirin protease NS3 catalytic subunitNon-structural protein 3NS4ANS4BNon-structural protein 5
Recombinant Yellow fever virus Genome polyprotein is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Yellow fever virus (strain 17D vaccine) (YFV). Target Name: Yellow fever virus Genome polyprotein. Target Synonyms: Core proteinMatrix proteinNS2ANS1NS2A-alphaFlavivirin protease NS2B regulatory subunit. Accession Number: P03314. Expression Region: 286~730aa. Tag Info: N-Terminal 10Xhis-Gst-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 78.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 78.4kDa
Tag: N-Terminal 10Xhis-Gst-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: AHCIGITDRDFIEGVHGGTWVSATLEQDKCVTVMAPDKPSLDISLETVAIDRPAEVRKVCYNAVLTHVKINDKCPSTGEAHLAEENEGDNACKRTYSDRGWGNGCGLFGKGSIVACAKFTCAKSMSLFEVDQTKIQYVIRAQLHVGAKQENWNTDIKTLKFDALSGSQEVEFIGYGKATLECQVQTAVDFGNSYIAEMETESWIVDRQWAQDLTLPWQSGSGGVWREMHHLVEFEPPHAATIRVLALGNQEGSLK
Target-Kategorie: Yellow fever virus Genome polyprotein