Recombinant E. coli O9:H4 L-lactate dehydrogenase (lldD), Unconjugated

Artikelnummer: BIM-RPC22853
Artikelname: Recombinant E. coli O9:H4 L-lactate dehydrogenase (lldD), Unconjugated
Artikelnummer: BIM-RPC22853
Hersteller Artikelnummer: RPC22853
Alternativnummer: BIM-RPC22853-20UG,BIM-RPC22853-100UG,BIM-RPC22853-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: E. coli
Konjugation: Unconjugated
Alternative Synonym: lldD, EcHS_A3817L-lactate dehydrogenase, EC 1.1
Recombinant E. coli O9:H4 L-lactate dehydrogenase (lldD) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli O9:H4 (strain HS). Target Name: lldD. Target Synonyms: lldD, EcHS_A3817L-lactate dehydrogenase, EC 1.1. Accession Number: A8A670. Expression Region: 1~396aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 46.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 46.7kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MIISAASDYRAAAQRILPPFLFHYMDGGAYSEYTLRRNVEDLSEVALRQRILKNMSDLSLETTLFNEKLSMPVALAPVGLCGMYARRGEVQAAKAADAHGIPFTLSTVSVCPIEEVAPAIKRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPTPGARYRDAHSGMSGPNAAMRRYLQAVTHPQWAWDVGLNGRPHDLGNISAYLGKPTGLEDYIGWLGNNFDPSISWKDLEWIRDFWDGPMVIKGILD
Target-Kategorie: lldD