Recombinant Laribacter hongkongensis Orotate phosphoribosyltransferase (pyrE), Unconjugated, E. coli

Artikelnummer: BIM-RPC22866
Artikelname: Recombinant Laribacter hongkongensis Orotate phosphoribosyltransferase (pyrE), Unconjugated, E. coli
Artikelnummer: BIM-RPC22866
Hersteller Artikelnummer: RPC22866
Alternativnummer: BIM-RPC22866-20UG,BIM-RPC22866-100UG,BIM-RPC22866-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: OPRTOPRTase
Recombinant Laribacter hongkongensis Orotate phosphoribosyltransferase (pyrE) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Laribacter hongkongensis (strain HLHK9). Target Name: pyrE. Target Synonyms: OPRTOPRTase. Accession Number: C1D6F5. Expression Region: 1~213aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 38.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 38.9kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MSDFRQDFIRFAVEEQVLRFGEFVTKAGRPSPYFFNAGLFNHGASLLSLARFYARSISESGIAFDMLFGPAYKGIVLAGATAMMLAEQGRDVPFAFNRKEAKDHGEGGTLIGAPLKGRVLIIDDVISAGTSVRESVEIIRANGAEPAGVAIALDRMERGQGELSATQEVAQKFGLPVVAIASLDDLLGFLAGSPDLADNLTRVEAYRTQYGVR
Target-Kategorie: pyrE