Recombinant Aeromonas hydrophila FKBP-type peptidyl-prolyl cis-trans isomerase FkpA (fkpA), Unconjugated, E. coli

Artikelnummer: BIM-RPC22879
Artikelname: Recombinant Aeromonas hydrophila FKBP-type peptidyl-prolyl cis-trans isomerase FkpA (fkpA), Unconjugated, E. coli
Artikelnummer: BIM-RPC22879
Hersteller Artikelnummer: RPC22879
Alternativnummer: BIM-RPC22879-20UG,BIM-RPC22879-100UG,BIM-RPC22879-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: Rotamase
Recombinant Aeromonas hydrophila FKBP-type peptidyl-prolyl cis-trans isomerase FkpA (fkpA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Aeromonas hydrophila. Target Name: fkpA. Target Synonyms: Rotamase. Accession Number: O08437. Expression Region: 21~268aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 42.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 42.7kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: CQKDEKTAANTAEVKAEASKPAEAPKAEAKSFEEQSGYAIGLSMGRYIANTLERQQELGIKLDNSVILKGVTDGLGKEAKMTDEEIQKVLQQYDAKINELTKAKADKDAVENQKKGEEYLAANAKKEGVKSTESGLQYQVEKMGTGAKPKATDIVKVHYTGTLTDGTKFDSSVDRGEPATFPLNQVIPGWTEGVQLMPVGSKFKFFLPSKLAYGEHGAGSIPANAVLVFDVELLAIEKPAADGDNAKK
Target-Kategorie: fkpA