Recombinant Apis mellifera Major royal jelly protein 1 (MRJP1), Unconjugated, E. coli

Artikelnummer: BIM-RPC22898
Artikelname: Recombinant Apis mellifera Major royal jelly protein 1 (MRJP1), Unconjugated, E. coli
Artikelnummer: BIM-RPC22898
Hersteller Artikelnummer: RPC22898
Alternativnummer: BIM-RPC22898-20UG,BIM-RPC22898-100UG,BIM-RPC22898-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bee
Konjugation: Unconjugated
Alternative Synonym: 56- kDa protein 4, p56kP-4Bee-milk proteinRoyalactin
Recombinant Apis mellifera Major royal jelly protein 1 (MRJP1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Apis mellifera (Honeybee). Target Name: MRJP1. Target Synonyms: 56- kDa protein 4, p56kP-4Bee-milk proteinRoyalactin. Accession Number: O18330. Expression Region: 20~432aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 73.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 73.9kDa
Tag: N-Terminal Gst-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: NILRGESLNKSLPILHEWKFFDYDFGSDERRQDAILSGEYDYKNNYPSDIDQWHDKIFVTMLRYNGVPSSLNVISKKVGDGGPLLQPYPDWSFAKYDDCSGIVSASKLAIDKCDRLWVLDSGLVNNTQPMCSPKLLTFDLTTSQLLKQVEIPHDVAVNATTGKGRLSSLAVQSLDCNTNSDTMVYIADEKGEGLIVYHNSDDSFHRLTSNTFDYDPKFTKMTIDGESYTAQDGISGMALSPMTNNLYYSPVASTS
Target-Kategorie: MRJP1