Recombinant Bacillus sp. Levanase, Unconjugated, E. coli

Artikelnummer: BIM-RPC22901
Artikelname: Recombinant Bacillus sp. Levanase, Unconjugated, E. coli
Artikelnummer: BIM-RPC22901
Hersteller Artikelnummer: RPC22901
Alternativnummer: BIM-RPC22901-20UG,BIM-RPC22901-100UG,BIM-RPC22901-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: 2,6-beta-D-fructan fructanohydrolaseEndo-levanase
Recombinant Bacillus sp. Levanase is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bacillus sp. (strain L7). Target Name: Bacillus sp. Levanase. Target Synonyms: 2,6-beta-D-fructan fructanohydrolaseEndo-levanase. Accession Number: O31411. Expression Region: 451~579aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 30.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 30.3kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: LPWNDLGHVWSGSAVADTTNASGLFGSSGGKGLIAYYTSYNPDRHNGNQKIGLAYSTDRGRTWKYSEEHPVVIENPGKTGEDPGGWDFRDPKVVRDEANNRWVMVVSGGDHIRLFTSTNLLNWTLTDQF
Target-Kategorie: Bacillus sp. Levanase