Recombinant Taraxacum officinale Root allergen protein, Unconjugated, E. coli

Artikelnummer: BIM-RPC22923
Artikelname: Recombinant Taraxacum officinale Root allergen protein, Unconjugated, E. coli
Artikelnummer: BIM-RPC22923
Hersteller Artikelnummer: RPC22923
Alternativnummer: BIM-RPC22923-20UG,BIM-RPC22923-100UG,BIM-RPC22923-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Konjugation: Unconjugated
Alternative Synonym: RAP
Recombinant Taraxacum officinale Root allergen protein is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Taraxacum officinale (Common dandelion) (Leontodon taraxacum). Target Name: Taraxacum officinale Root allergen protein. Target Synonyms: RAP. Accession Number: O49065. Expression Region: 1~157aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 37kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 37kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MAVAEFEITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYSDGVPFTSSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMVFKCKGDAKLTDENVSLMKEGLKKTFKAIETYVISHPEAC
Target-Kategorie: Taraxacum officinale Root allergen protein