Recombinant E. coli S-ribosylhomocysteine lyase (luxS), Unconjugated

Artikelnummer: BIM-RPC22941
Artikelname: Recombinant E. coli S-ribosylhomocysteine lyase (luxS), Unconjugated
Artikelnummer: BIM-RPC22941
Hersteller Artikelnummer: RPC22941
Alternativnummer: BIM-RPC22941-20UG,BIM-RPC22941-100UG,BIM-RPC22941-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: E. coli
Konjugation: Unconjugated
Alternative Synonym: AI-2 synthesis protein, Autoinducer-2 production protein LuxS
Recombinant E. coli S-ribosylhomocysteine lyase (luxS) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli (strain K12). Target Name: luxS. Target Synonyms: AI-2 synthesis protein, Autoinducer-2 production protein LuxS. Accession Number: P45578. Expression Region: 2~171aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 23.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 23.3kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: PLLDSFTVDHTRMEAPAVRVAKTMNTPHGDAITVFDLRFCVPNKEVMPERGIHTLEHLFAGFMRNHLNGNGVEIIDISPMGCRTGFYMSLIGTPDEQRVADAWKAAMEDVLKVQDQNQIPELNVYQCGTYQMHSLQEAQDIARSILERDVRINSNEELALPKEKLQELHI
Target-Kategorie: luxS