Recombinant Mycoplasma pneumoniae Methionine aminopeptidase (map), Unconjugated, E. coli

Artikelnummer: BIM-RPC22958
Artikelname: Recombinant Mycoplasma pneumoniae Methionine aminopeptidase (map), Unconjugated, E. coli
Artikelnummer: BIM-RPC22958
Hersteller Artikelnummer: RPC22958
Alternativnummer: BIM-RPC22958-20UG,BIM-RPC22958-100UG,BIM-RPC22958-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: MAPUniRule annotationMetAPUniRule annotationPeptidase M
Recombinant Mycoplasma pneumoniae Methionine aminopeptidase (map) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mycoplasma pneumoniae (strain ATCC 29342 / M129). Target Name: map. Target Synonyms: MAPUniRule annotationMetAPUniRule annotationPeptidase M. Accession Number: Q11132. Expression Region: 1~248aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 43.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 43.7kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MVYLKSAREVEQIRQACKIFQEAKAYFTIERLLGKSLTAIDQALKQFIESKGATCAFHKYQNFPGFNCLSLNETVIHGIADNRVFGVKDKLTLDIGINLNGYICDAAFTVLGPKAPEPMQTLLEVTEACFTAVVEPQLRPNNPTGNVSHAIQTYFESKGYYLLKQFGGHGCGIKVHEEPLILNYGKPDTGTKLEPGMVLCIEPMVMTDSDAMVMHNNSWNVLTPKSRYNCHVEQMYVITTSGFECLTN
Target-Kategorie: map