Recombinant Human Lymphocyte antigen 6E (LY6E), Unconjugated, E. coli

Artikelnummer: BIM-RPC23009
Artikelname: Recombinant Human Lymphocyte antigen 6E (LY6E), Unconjugated, E. coli
Artikelnummer: BIM-RPC23009
Hersteller Artikelnummer: RPC23009
Alternativnummer: BIM-RPC23009-20UG,BIM-RPC23009-100UG,BIM-RPC23009-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Retinoic acid-induced gene E proteinRIG-EStem cell antigen 2SCA-2Thymic shared antigen 1TSA-1
Recombinant Human Lymphocyte antigen 6E (LY6E) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: LY6E. Target Synonyms: Retinoic acid-induced gene E proteinRIG-EStem cell antigen 2SCA-2Thymic shared antigen 1TSA-1. Accession Number: Q16553. Expression Region: 21~101aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 24.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 24.5kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS
Target-Kategorie: LY6E