Recombinant Human Mediator of RNA polymerase II transcription subunit 1 (MED1), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC23026
Artikelname: Recombinant Human Mediator of RNA polymerase II transcription subunit 1 (MED1), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC23026
Hersteller Artikelnummer: RPC23026
Alternativnummer: BIM-RPC23026-20UG,BIM-RPC23026-100UG,BIM-RPC23026-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Activator-recruited cofactor 205 kDa componentARC205Mediator complex subunit 1Peroxisome proliferator-activated receptor-binding proteinPBPPPAR-binding proteinThyroid hormone receptor-associated protein complex 220 kDa componentTrap220Thyroid receptor-interacting protein 2TR-interacting protein 2TRIP-2Vitamin D receptor-interacting protein complex component DRIP205p53 regulatory protein RB18A
Recombinant Human Mediator of RNA polymerase II transcription subunit 1 (MED1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: MED1. Target Synonyms: Activator-recruited cofactor 205 kDa componentARC205Mediator complex subunit 1Peroxisome proliferator-activated receptor-binding proteinPBPPPAR-binding protein. Accession Number: Q15648. Expression Region: 878~1031aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 32.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 32.2kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: FGEEYFDESSQSGDNDDFKGFASQALNTLGVPMLGGDNGETKFKGNNQADTVDFSIISVAGKALAPADLMEHHSGSQGPLLTTGDLGKEKTQKRVKEGNGTSNSTLSGPGLDSKPGKRSRTPSNDGKSKDKPPKRKKADTEGKSPSHSSSNRPF
Target-Kategorie: MED1