Recombinant Human Secretory phospholipase A2 receptor (PLA2R1), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC23046
Artikelname: Recombinant Human Secretory phospholipase A2 receptor (PLA2R1), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC23046
Hersteller Artikelnummer: RPC23046
Alternativnummer: BIM-RPC23046-20UG,BIM-RPC23046-100UG,BIM-RPC23046-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: 180 kDa secretory phospholipase A2 receptorC-type lectin domain family 13 member CM-type receptor
Recombinant Human Secretory phospholipase A2 receptor (PLA2R1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: PLA2R1. Target Synonyms: 180 kDa secretory phospholipase A2 receptorC-type lectin domain family 13 member CM-type receptor. Accession Number: Q13018. Expression Region: 395~530aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 19.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 19.4kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID
Target-Kategorie: PLA2R1