Recombinant Human Dihydropyrimidinase-related protein 1 (CRMP1), Unconjugated, E. coli

Artikelnummer: BIM-RPC23051
Artikelname: Recombinant Human Dihydropyrimidinase-related protein 1 (CRMP1), Unconjugated, E. coli
Artikelnummer: BIM-RPC23051
Hersteller Artikelnummer: RPC23051
Alternativnummer: BIM-RPC23051-20UG,BIM-RPC23051-100UG,BIM-RPC23051-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Collapsin response mediator protein 1
Recombinant Human Dihydropyrimidinase-related protein 1 (CRMP1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CRMP1. Target Synonyms: Collapsin response mediator protein 1. Accession Number: Q14194. Expression Region: 1~572aa. Tag Info: Tag-Free. Theoretical MW: 62.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 62.2kDa
Tag: Tag-Free
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MSYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGGIDVNTYLQKPSQGMTAADDFFQGTRAALVGGTTMIIDHVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQMSDSQLYEAFTFLKGLGAVILVHAENGDLIAQEQKRILEMGITGPEGHALSRPEELEAEAVFRAITIAGRINCPVYITKV
Target-Kategorie: CRMP1